EWSR1

Western blot analysis of EWSR1 using anti-EWSR1 antibody  Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: Rat skeletal muscle Tissue Lysate,
Lane 2: Mouse skeletal muscle Tissue Lysate,
Lane 3: Mouse HEPA1-6 Whole Cell Lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT.
The membrane was incubated with rabbit anti-EWSR1 antigen affinity purified polyclonal antibody at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3
times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit  with
Tanon 5200 system. A specific band was detected for EWSR1 at approximately 90KD. The expected band size for EWSR1 is at
68KD.

Western blot analysis of EWSR1 using anti-EWSR1 antibody Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: Rat skeletal muscle Tissue Lysate, Lane 2: Mouse skeletal muscle Tissue Lysate, Lane 3: Mouse HEPA1-6 Whole Cell Lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-EWSR1 antigen affinity purified polyclonal antibody at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for EWSR1 at approximately 90KD. The expected band size for EWSR1 is at 68KD.

Catalog Number:AB-84177
Size:100 ug
Concentration:1mg/ml
Host:Rb
Isotype:IgG
Clone:POLY
Immunogen:A synthetic peptide corresponding to a sequence in the middle region of human EWSR1. (369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH), different from the related mouse sequence by one amino acid.
Reactivity:Hu, Ms, Rt
Applications:Western blot: 1:2000-1:10.000 Immunohistochemistry(Paraffin-embedded Section): 1:1000-1:2000 Immunohistochemistry(Frozen Section): 1:1000-1:2000 Immunocytochemistry: 1:500 Immunofluorescence: 1:500 Flow Cytometry: 1-3μg/1x106 cells, Human
Purification:Aff. Pur.
Form:Liquid

Applications

Western blot: 1:2000-1:10.000 Immunohistochemistry(Paraffin-embedded Section): 1:1000-1:2000 Immunohistochemistry(Frozen Section): 1:1000-1:2000 Immunocytochemistry: 1:500 Immunofluorescence: 1:500 Flow Cytometry: 1-3μg/1x106 cells, Human

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human EWSR1. (369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH), different from the related mouse sequence by one amino acid.